Protein Info for PP_0366 in Pseudomonas putida KT2440

Annotation: dethiobiotin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 4 to 212 (209 residues), 121.1 bits, E=5.4e-39
• PF01656: CbiA
  • amino acids 6 to 211 (206 residues), 53.4 bits, E=2.6e-18
• TIGR00347: dethiobiotin synthase
  • amino acids 6 to 177 (172 residues), 149.5 bits, E=5e-48

Best Hits

Swiss-Prot: 73% identical to BIOD_PSEA7: ATP-dependent dethiobiotin synthetase BioD (bioD) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 100% identity to ppf:Pput_0392)

MetaCyc: 48% identical to dethiobiotin synthetase (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

See Q88QW8 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PP_0366 dethiobiotin synthetase (Pseudomonas putida KT2440)
MSQAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGCTMTPKGLRNSDALALI
DESTVKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAAMRNVLQQNADFTLIEGAG
GWRVPLSGLENLSDLAVALRLRVILVVGVRLGCISHALLSAEAIERDGLQLAGWVANIIE
PRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAEHLQLDLLD