Protein Info for PP_0362 in Pseudomonas putida KT2440

Annotation: Biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00433: biotin synthase" amino acids 20 to 316 (297 residues), 409.8 bits, see alignment E=3.2e-127 PF04055: Radical_SAM" amino acids 55 to 210 (156 residues), 76.9 bits, see alignment E=2.1e-25 PF06968: BATS" amino acids 226 to 316 (91 residues), 104.3 bits, see alignment E=3.2e-34

Best Hits

Swiss-Prot: 100% identical to BIOB_PSEPK: Biotin synthase (bioB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to ppu:PP_0362)

MetaCyc: 70% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QX2 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PP_0362 Biotin synthase (Pseudomonas putida KT2440)
MSASTTATTRHDWALAEVKALFQQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACP
EDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVL
EMVKGVKAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERL
QTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAE
EEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTA
NPQADKDMQLFARLGIKPEAREEHADEVHQAAIEQALVEQRSSEMFYDAATA