Protein Info for PP_0354 in Pseudomonas putida KT2440

Annotation: CBS domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 PF00571: CBS" amino acids 180 to 233 (54 residues), 42 bits, see alignment 1.9e-14 amino acids 248 to 295 (48 residues), 37.6 bits, see alignment 4.5e-13 PF03445: DUF294" amino acids 323 to 462 (140 residues), 149.7 bits, see alignment E=9.9e-48 PF10335: DUF294_C" amino acids 499 to 643 (145 residues), 153.5 bits, see alignment E=7.2e-49

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to ppu:PP_0354)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QY0 at UniProt or InterPro

Protein Sequence (645 amino acids)

>PP_0354 CBS domain protein (Pseudomonas putida KT2440)
MSKKDAYSQAGKTAVLQNIQGTLQFLQRFPPFNQMEHSHLAFLVEQCQLRFYACGESIVK
PADGPVEHFYIVKQGRVVGERQHLAKPGVETTFEITSGECFPLAALLGERATRTEHLAGE
DTFCLQLNKAAFIRVFSMSDVFRDFALRGVSSLLDQVNQQVRQRAVETLGTQYSLNTPLG
ELAMRHPVVCSAHTPLREAVRLMHEQQVGSIVVVDPQRYPIGIFTLRDLRQVVATVDTDL
GAAIDRHMTAKPFYLPPQASAFDAAMAMTERHIAHVCLVENGRLCGVVSERDLFSLQRVD
LVHLARTIRHAPRLDTLVSLRGEISQLVERMLAHGASSTQITQIITLLNDHTVCRVIELA
LAERGDPGVPFSWLCFGSEGRREQTLHTDQDNGILFEAVDSAEADAIRARLLPLAQYINQ
CLAQCGFTLCMGNVMAGNPELCLSRSEWARRFAGFVREASPENLLGSSIYFDLRVVWGDE
QGCEQLRQGLLAQVADNRIFQRMMADNALRQRPPVGRLREFVLTRQGNDKAATLDLKVQG
LTPFVDGARLLALANGIAACNTLERLRQLVAKGVIEPLDGAAYEEAYHFIQQTRMQQHQR
QIRDNLPYSNRLDPDSLNHLDRRILRESLRQAQRLQSSLALRYQL