Protein Info for PP_0336 in Pseudomonas putida KT2440

Annotation: Peptide methionine sulfoxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details PF01625: PMSR" amino acids 54 to 208 (155 residues), 188.9 bits, see alignment E=4.1e-60 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 54 to 206 (153 residues), 210.3 bits, see alignment E=8.9e-67

Best Hits

Swiss-Prot: 100% identical to MSRA_PSEPK: Peptide methionine sulfoxide reductase MsrA (msrA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to ppf:Pput_0361)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QZ8 at UniProt or InterPro

Protein Sequence (222 amino acids)

>PP_0336 Peptide methionine sulfoxide reductase MsrA (Pseudomonas putida KT2440)
MVLRSEILVNKNVMPTAEQALPGRDTPMSLPEFHYVFKDTPLLGPFFEGAIDFAIFGLGC
FWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHTEVVLVVFDKDKVSYRELL
AMFWELHNPTQGMRQGNDIGTQYRSAIYCTSPEQLEQAKASRDAFQAELSKAGFGEITTE
IDQAPTVYFAEAYHQQYLAKNPDGYCGIGGTGVCLPPSLQGN