Protein Info for PP_0317 in Pseudomonas putida KT2440

Annotation: Methyl-accepting chemotaxis transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 5 to 185 (181 residues), 74.1 bits, see alignment E=1.6e-24 PF00672: HAMP" amino acids 209 to 261 (53 residues), 35 bits, see alignment 2.2e-12 PF00015: MCPsignal" amino acids 325 to 507 (183 residues), 147.6 bits, see alignment E=5.2e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_0317)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R17 at UniProt or InterPro

Protein Sequence (541 amino acids)

>PP_0317 Methyl-accepting chemotaxis transducer (Pseudomonas putida KT2440)
MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAIEQVSVPSIKILDELTA
LNLRMRTLSYRLLLNREPATQRDTLDMLDQRNSQIDRARQAYLPMIVAADEQAAFDQYGQ
LLNQYRQLESRMRTLSQADRLDELRDLLNRDLLANSEQINKVMDTLVRINTDQTRATNEK
AANQYAGAFALVIGLLVAATVLTFACAFLLTRSIVKPIEEALKCAEQVADGDLTHVIRAE
GTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASAAEELNAVTDESARGLQQQNNEIEQ
AATAVTEMTSAVEEVARNAVSTSEASSEASRSTGDGRDLVMETVGAIERMSGDVQATAKL
ITHLAEQSRDIGKVLDVIRGLADQTNLLALNAAIEAARAGEAGRGFAVVADEVRALAHRT
QQSTSEIERMIGSIQGGTEEAVESMRTSTERAESTLNIARGAGMALDTIAGAVAQINERN
LVIASAAEEQAQVAREVDRNLVNINDLSVQSATGAHQTSAASAELSRLAVDLNGLVARFR
T