Protein Info for PP_0316 in Pseudomonas putida KT2440

Annotation: putative glycine-betaine dioxygenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00970: FAD_binding_6" amino acids 28 to 118 (91 residues), 54.2 bits, see alignment E=2.4e-18 PF00175: NAD_binding_1" amino acids 131 to 236 (106 residues), 55.4 bits, see alignment E=1.4e-18 PF00111: Fer2" amino acids 290 to 361 (72 residues), 49.2 bits, see alignment E=6.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0316)

MetaCyc: 82% identical to glycine betaine monooxygenase ferredoxin reductase subunit (Pseudomonas aeruginosa)
RXN-22705 [EC: 1.14.13.251]

Predicted SEED Role

"GbcB Glycine betaine demethylase subunit B" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R18 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_0316 putative glycine-betaine dioxygenase subunit (Pseudomonas putida KT2440)
MNMSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPIMFFFKPGQFVTLEL
EIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMHEGAELPVHGPVGLFNA
IDFPAGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSPKDIIYHRELEQMASR
IPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYMERVVFCCGPTPYMTAVKRMLE
AVGFDMKNYHEESFGATPPEAKADAVEHAEQAADAPELDVSDLNLVEFIGSEKSIRIAPG
ETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVEMEHNGGITEEDEAEGYILSCCSVP
KGDVRIDY