Protein Info for PP_0304 in Pseudomonas putida KT2440

Annotation: Carnitine uptake ABC transporter, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03414: choline ABC transporter, periplasmic binding protein" amino acids 23 to 310 (288 residues), 419.7 bits, see alignment E=3.1e-130 PF04069: OpuAC" amino acids 31 to 284 (254 residues), 199.8 bits, see alignment E=3.1e-63

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to ppu:PP_0304)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R30 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PP_0304 Carnitine uptake ABC transporter, periplasmic component (Pseudomonas putida KT2440)
MHSLIRRSLLPLALSSIVATPLFAAEPAACKNVRLGVVNWTDVIATSAMAQVLLDGLGYQ
TKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDANQFKVLDKPSLEDARATLA
VPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQIKAMITKNQFDLGKFQLVESS
EAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLGDSQDALGPDEGRATVWTVTAPD
YAERCPNALRLLANLKFSAEDESRMMQPLLDHKDALESARQWLKDHPEDKARWLEGVTTF
DGKPAADNLKLTAN