Protein Info for PP_0303 in Pseudomonas putida KT2440

Annotation: dehydrocarnitine cleavage enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF05853: BKACE" amino acids 5 to 291 (287 residues), 325.6 bits, see alignment E=1.2e-101

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_0327)

MetaCyc: 82% identical to 3-dehydrocarnitine cleavage enzyme (Pseudomonas aeruginosa PAO1)
2.3.1.M85 [EC: 2.3.1.M85]

Predicted SEED Role

"FIG004891: hypothetical protein in carnitine cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.M85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R31 at UniProt or InterPro

Protein Sequence (294 amino acids)

>PP_0303 dehydrocarnitine cleavage enzyme (Pseudomonas putida KT2440)
MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGATVVHCHVRDPQTGRFSR
DVALYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAFGPGTDLIGPLERLAHVEA
LLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELGVKAELEIFDTGHLWFAKQMM
KEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANVTWAGFGIGRMQMPMAAQAVLLG
GNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMGGRVLSPAEGREKMNLKRR