Protein Info for PP_0298 in Pseudomonas putida KT2440

Annotation: AraC-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 22 to 185 (164 residues), 54.7 bits, see alignment E=1.6e-18 PF12833: HTH_18" amino acids 247 to 324 (78 residues), 79.2 bits, see alignment E=3.5e-26 PF00165: HTH_AraC" amino acids 286 to 321 (36 residues), 28.7 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 44% identical to CDHR_PSEAE: HTH-type transcriptional regulator CdhR (cdhR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to ppw:PputW619_4910)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R36 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_0298 AraC-family transcriptional regulator (Pseudomonas putida KT2440)
MTSYTSGNPTQNRTTPQSIGFLLLDNFTLISLASAVEPLRMANQLSGRELYRWHTLTIDG
GQVWASDGLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREHVTWLQAQARQSRRLGAVC
TGSWALACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRLFTLDRNRFTSSGGTAPLDMM
LHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGTNQPKLQEIVALMEANLEE
PIDLDELAVYVSVSRRQLERLFQKYLHCSPSRYYLKLRLIRARQLLKQTPMSIIEVASVC
GFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVAMMPIPQAMTLSPHSGPMAALSQARNE
STFASVRL