Protein Info for PP_0258 in Pseudomonas putida KT2440

Annotation: regulator of murein cross-linking

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF04972: BON" amino acids 23 to 87 (65 residues), 54.4 bits, see alignment E=1.2e-18 PF01476: LysM" amino acids 98 to 145 (48 residues), 37 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 57% identical to KBP_ECOL6: Potassium binding protein Kbp (kbp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0258)

Predicted SEED Role

"FIG00954962: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R76 at UniProt or InterPro

Protein Sequence (146 amino acids)

>PP_0258 regulator of murein cross-linking (Pseudomonas putida KT2440)
MSLFSFVKEAGEKLIDLLTPGNANAEEQLKKHVEAVGLGNPNITATVEGDKIILKGEVAS
QEEKEKIILAAGNISGVASVEDQITVTGPVVQAARFVTVKSGDTLSAIAMVVYGNANQYN
KIFEANKPMLKHPDKIYPGQVLRIPD