Protein Info for PP_0237 in Pseudomonas putida KT2440

Annotation: aliphatic sulfonate ABC transporter - periplasmic binding protein / transport of isethionate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13379: NMT1_2" amino acids 27 to 255 (229 residues), 47.6 bits, see alignment E=4.1e-16 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 31 to 312 (282 residues), 253.5 bits, see alignment E=1.2e-79 PF04069: OpuAC" amino acids 50 to 251 (202 residues), 45.6 bits, see alignment E=1.4e-15 PF12974: Phosphonate-bd" amino acids 50 to 188 (139 residues), 37.6 bits, see alignment E=3.3e-13 PF09084: NMT1" amino acids 55 to 249 (195 residues), 62.5 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppg:PputGB1_0261)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R96 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PP_0237 aliphatic sulfonate ABC transporter - periplasmic binding protein / transport of isethionate (Pseudomonas putida KT2440)
MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLLKAKGTLEKRLAEQGVQ
VQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYVAYEPPAPHSEAILVPK
GSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSDIQPVYLPPADARAAFERGSV
DAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLATRNYATQHPAVINTVIEEVRAVG
EWSQANPQEVTDQVAPLLGLPAGITLTSVKRQGYGAAPLTPEVVAAQQKIADTFQALKLI
PKPLSIKDVIWTPPAKVASAP