Protein Info for PP_0231 in Pseudomonas putida KT2440

Annotation: taurine ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 271 (170 residues), 92.4 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 64% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ppu:PP_0231)

MetaCyc: 64% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RA2 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PP_0231 taurine ABC transporter permease subunit (Pseudomonas putida KT2440)
MSSLDLPVAGKHNTQIRPAATLRRPLSTRWISTLTLASLLMVWWLVTAAGWVEPLFLPSP
GDILAKAWTLLTQGYMDASLWQHLSASLGRIGLALVAATLTAIPVGIAIGYNRVARGILD
PLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAIATATGVRTVDPAKLRAA
QSLGATKAQLIRHVILPSALPDILTGIRIGLGVGWSTLVAAELIAATSGLGFMVQSAAQF
LVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHGQIH