Protein Info for PP_0223 in Pseudomonas putida KT2440

Annotation: Monooxygenase, DszC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR04022: sulfur acquisition oxidoreductase, SfnB family" amino acids 17 to 405 (389 residues), 623.2 bits, see alignment E=8.1e-192 PF02771: Acyl-CoA_dh_N" amino acids 32 to 128 (97 residues), 40.9 bits, see alignment E=4.7e-14 PF02770: Acyl-CoA_dh_M" amino acids 139 to 222 (84 residues), 34 bits, see alignment E=5.3e-12 PF08028: Acyl-CoA_dh_2" amino acids 248 to 381 (134 residues), 75.1 bits, see alignment E=1.3e-24 PF00441: Acyl-CoA_dh_1" amino acids 248 to 379 (132 residues), 34.9 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0223)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RB0 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PP_0223 Monooxygenase, DszC family (Pseudomonas putida KT2440)
MCRKAAPMAPENNMTTNIITSDAQALAVAEDIAQQLRRDSALRDRERRLPLAELELFTRS
GLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSPEQQQR
LYAEVLAGRRFGNALAELGTKTAHERTTRLSRDGDGFRINGRKFYSTGAIYAQRIPTSVV
DEQGIQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVPFQSAFERPT
PVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPLTLKSFGHLAVR
LHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLTAGTTLFELGGSQA
TLAEHNLDRHWRNARVHTLHDPVRWKYHAIGNYYLNDANPPRRGTI