Protein Info for PP_0220 in Pseudomonas putida KT2440

Annotation: methionine import ATP-binding protein metN2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00005: ABC_tran" amino acids 50 to 198 (149 residues), 128.8 bits, see alignment E=3.5e-41 PF09383: NIL" amino acids 304 to 359 (56 residues), 30 bits, see alignment 5.9e-11

Best Hits

Swiss-Prot: 100% identical to METN2_PSEPK: Methionine import ATP-binding protein MetN 2 (metN2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to ppu:PP_0220)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RB3 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PP_0220 methionine import ATP-binding protein metN2 (Pseudomonas putida KT2440)
MSQASALRAPTPQALPPMAREQALRPDVNEAHVRFIGLGKTYPGQAQPALQGIDLNIRHG
EIFGIIGRSGAGKSSLLRTINRLEQPSQGRVLIDQVDIAPFNEDQLVALRRRIGMIFQHF
NLMSAKTVWQNVELPLKVAGVAKAERQRKVRELLELVGLQEKHHVYPAQLSGGQKQRVGI
ARALVHTPEILLCDEATSALDPETTASILELLRDINQRLGLTIVLITHEMAVIRDICHRV
VVLERGAVVEQGEVWRVFGSPRHEVTRTLLAPLQAKLPAALQASLQAHPASGNSAVVLKL
TVLGEPELSALFNDLGGRVRLLQGGVETIGEHALGQLILSVQHSPHDTHQLLERARRWAE
DVEVLGHVD