Protein Info for PP_0218 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 81 to 206 (126 residues), 65.6 bits, see alignment E=4.6e-22 PF13188: PAS_8" amino acids 88 to 127 (40 residues), 29.2 bits, see alignment 2.2e-10 PF00989: PAS" amino acids 89 to 196 (108 residues), 47.6 bits, see alignment E=5.3e-16 PF08448: PAS_4" amino acids 91 to 198 (108 residues), 28.3 bits, see alignment E=6.1e-10 PF13426: PAS_9" amino acids 96 to 197 (102 residues), 58.5 bits, see alignment E=2.5e-19 PF08447: PAS_3" amino acids 107 to 192 (86 residues), 31.5 bits, see alignment E=6.1e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 207 to 368 (162 residues), 121.6 bits, see alignment E=2.8e-39 PF00990: GGDEF" amino acids 210 to 365 (156 residues), 154.9 bits, see alignment E=5.7e-49 PF00563: EAL" amino acids 387 to 622 (236 residues), 259 bits, see alignment E=1.3e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0218)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RB5 at UniProt or InterPro

Protein Sequence (631 amino acids)

>PP_0218 Sensory box protein (Pseudomonas putida KT2440)
MSVSVRDALRMAALYVVLSILWLALAEVMLHSMTDDPLALTVGRQINVVVWVLLSALLIY
VSRVRLLNFIGHGARLRCEDRERLRMAAAVFDSTLEGVLVTDRQGLIVHVNRAFMRITGY
QQDEVIGQRPSKFKSGHHGLAFYQEVFATLAEKGEWSGEIWNRRKSGEIYPQWQTICAIR
DDEGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGLPNRLLFTDRLEQALAAAQANKR
GCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLGEVLGNGVTLARLGGDEFGVLVENC
QQVGQAGKLAQCIIERMREPFQFDGNRLFISASVGISLYPSDALGAEQLLRNADSALYKA
KSNGRACYALYTEELTAHAQHRVETAAELRRALEQDELRVYFQPVHDLASGRQVGVETLV
RWQHPRRGLVPPGEFIPIAERTGLIAEIDTWVLRQACRQMVQWQAQGRQLAFVGVNISSR
LFGQHELYRQVAEVLHDTGLAPALLELEVTESAVMEDPEVALEQLHRLRELGVTLAIDDF
GTGYSSLLRLKRLPVQKLKIDQGFVAGLPVDEDDIAIVRVIIALARSMGMQVHAEGIEQA
EQASFLLQEECQLGQGYWFGRPVPAEDLRWD