Protein Info for PP_0216 in Pseudomonas putida KT2440

Annotation: putative sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00229: PAS domain S-box protein" amino acids 50 to 177 (128 residues), 45.5 bits, see alignment E=7.7e-16 PF13188: PAS_8" amino acids 54 to 110 (57 residues), 20.3 bits, see alignment E=6.2e-08 PF08447: PAS_3" amino acids 77 to 164 (88 residues), 65.4 bits, see alignment E=7e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 177 to 339 (163 residues), 147.7 bits, see alignment E=2.7e-47 PF00990: GGDEF" amino acids 181 to 338 (158 residues), 152.4 bits, see alignment E=1.4e-48

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_0231)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RB7 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PP_0216 putative sensory box/GGDEF family protein (Pseudomonas putida KT2440)
MLAARFHVETCSVHMAKNIPTIFPGTPPPEAAQTLLALLHAQGEVARLSERDQLFSSLLD
SVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWRDSIYPDDLEFAERSLAQV
LLKGAVEDREYRILNADGQLRWLSDKCYINQQHDSDRVIIVGIAEDITEKKQLEGELQRL
ATTDVLTQSSNRRHFFECAQQAFDSAREDGTPLAFLLLDIDDFKRINDSYGHQEGDQVLQ
HIADSGKAVLRRGDLFGRIGGEEFAAVFPGCTAQIAEQIAERLQRQIQHLSFSHGQQTYG
VTVSQGLTGLTDEDVALDSLYARADAAMYQAKRQGKNQIVRG