Protein Info for PP_0207 in Pseudomonas putida KT2440

Annotation: putative Nitrate ABC transporter, periplasmic nitrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13379: NMT1_2" amino acids 58 to 268 (211 residues), 42.3 bits, see alignment E=8.5e-15 PF09084: NMT1" amino acids 110 to 263 (154 residues), 32.8 bits, see alignment E=6.7e-12

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_0207)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RC5 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PP_0207 putative Nitrate ABC transporter, periplasmic nitrate-binding protein (Pseudomonas putida KT2440)
MRLVATVAGLALALTGLNASAETIRIAIGTQDTTINCATGGLLIRELGLLDKYLPHDGKY
KDATYQVEWKNFTSGAPLTNEMVAGKLDFGAMADFPGSFNGVAHLDAGKRSLFISVLSGS
VHGSGNGIVVPAASSVQSLAELKGKTISVPFASTAHGMLLRAVAAQGWDPQKDVRIIAQA
PEIAGSALRSNRIEAHADFVPFAELFPNRGFARKIYDGAQANAPTFHGALVDADYAKKYP
EVVTAYLRASLEADRLIAAQPEKYSELIEKVTGIEAEVNYLFHGPLGLQTRDLTWKPEYR
QAVATSIDTLKLLKKTDRGLDTGKFIDDQYIRAAFKEAGLDYDKALKDYDVLPLKADDAL
TGQPITDFSRLAQIWVRGEDKVRHYTSPEAALGALAQLEQEGKDIRAIYAQAADSGIKLL
ANQAWFVRNGKGELAAFLLKDQAEQYAKAHGGEALDFVSANQKLVAQR