Protein Info for PP_0180 in Pseudomonas putida KT2440

Annotation: putative cytochrome c family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 379 to 404 (26 residues), see Phobius details amino acids 416 to 438 (23 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details amino acids 483 to 502 (20 residues), see Phobius details amino acids 524 to 546 (23 residues), see Phobius details amino acids 554 to 575 (22 residues), see Phobius details amino acids 605 to 623 (19 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 136 to 219 (84 residues), 46.8 bits, see alignment E=4.8e-16 PF00034: Cytochrom_C" amino acids 138 to 221 (84 residues), 44.3 bits, see alignment E=5.6e-15 PF03239: FTR1" amino acids 383 to 583 (201 residues), 74.8 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to ppu:PP_0180)

Predicted SEED Role

"Cytochrome c family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RF0 at UniProt or InterPro

Protein Sequence (636 amino acids)

>PP_0180 putative cytochrome c family protein (Pseudomonas putida KT2440)
MKTRSRLLAWLPAALLGPVLALCSTLALAESPAEAAKAQHLLDYIGADYPPTVQDGKVID
EGEYREQQEFSAVLADLVKGLPANTEQAALEQGVQALRQAIDQRQEGTAVAKQARQLGAR
LAVAYEISQAPVITPDPARGAALYAQNCSICHGDTGAGDGPAGVGLEPAPANLRDVSRLD
QLSLFDLYNTLALGIDGTEMPSFADQLDDRQRWDVAAYIASFTAKPEAGKGDKTWNLADL
ARQTPAEVAANEGTAAVEAFRAQRAQPPQVKRGPAQLLEYTASTLEKSLAAYRAGDHDQA
YDLSVAAYLEGFELVESSLDNIDTQARKDTEKSLMAYRQSLQDGLPVEQAEQRLADAKTK
LEQAAKLLGSDGLSWTLSYISGLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNIGW
GLALVAGFATWALAAYVIDVGGAQRELLEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYI
KSSLVSGGGRFGFAVLAFFSVYRELFEVILFYETLWLQAGPAGHQAVLAGGATALVLLVG
LAWVILRGSAKLPLSLFFSINAALLCALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLG
IHADAYSLSAQAVALLAIVFLYGRSWLAEKRSAAAN