Protein Info for PP_0167 in Pseudomonas putida KT2440

Annotation: Toxin secretion ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 168 to 190 (23 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 20 to 714 (695 residues), 972.9 bits, see alignment E=4.6e-297 PF00664: ABC_membrane" amino acids 172 to 432 (261 residues), 80.2 bits, see alignment E=2.2e-26 PF00005: ABC_tran" amino acids 501 to 650 (150 residues), 115.6 bits, see alignment E=2.8e-37

Best Hits

KEGG orthology group: K12541, ATP-binding cassette, subfamily C, bacterial LapB (inferred from 100% identity to ppu:PP_0167)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RG3 at UniProt or InterPro

Protein Sequence (718 amino acids)

>PP_0167 Toxin secretion ATP-binding protein (Pseudomonas putida KT2440)
MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTTGLPLPAQRLSPELLPR
AAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWENDDTARLLLSESDGGEVH
VSREALLSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRDTLLRSKWLYIDAIAASLVIN
LIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYIFDLILKGLRGLCLDLAGKKTDL
IISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLRDFLASLTLTSLIDLPFTILILIVI
AIIGGHLVWIPIIAFPLALGIGYALQRPLMATMERTMALASERQSSLIETLAGLDAVKVN
NAESERQYMWEQTLGTLSRLELRVKVLSSLAMNITLLIQQLAGVAMICVGVYLIIDGNLS
MGGLVACYMLSGRALGPLGQLNGLLARYQQAKVTMVSTDHMMDLPQERNFEERPLSRKVL
QGSVEFRGVDFTYPNQQNLALKNINLTIRPGEKVGIIGRSGSGKSSLAKLIVGLYEADGG
SLLVDGVDIRQIDVSELRHNIGYVPQDIQLLAGTLRDNLVSGARYIEDELILQAAELAGV
HEFARLHPDGYELQVGERGQNLSGGQRQNVALGRALLLNPQILLLDEPTSAMDNTGEERL
KQRLQAVVEGKTVLLVTHRASLLSLVDRLIVIDRGQIVADGPKAAVMDALKKGQISVA