Protein Info for PP_0160 in Pseudomonas putida KT2440

Annotation: putative ferrioxamine receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 PF07660: STN" amino acids 85 to 129 (45 residues), 43.2 bits, see alignment 4.1e-15 PF07715: Plug" amino acids 173 to 278 (106 residues), 92.5 bits, see alignment E=3.5e-30 TIGR01783: TonB-dependent siderophore receptor" amino acids 175 to 828 (654 residues), 472.6 bits, see alignment E=1.2e-145 PF00593: TonB_dep_Rec" amino acids 355 to 797 (443 residues), 226.6 bits, see alignment E=1.7e-70

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_0160)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RH0 at UniProt or InterPro

Protein Sequence (828 amino acids)

>PP_0160 putative ferrioxamine receptor (Pseudomonas putida KT2440)
MSTNPVLTHTFSPNDFRPVLQSAHLRHAIRAVLFGTALGLATVPQLSVAADTAEVSQHYA
IPAGQLTDVLNTIARQAGITLSSTPQLTDGLHSNGLQGQYTADQALRQLLNGSGLEAVSQ
GGRNYVLQAQRQNAALALPDTDIRSFSLGNALGSMEGYNATHSQVATKTSMPLVETSQSV
SVVTRQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAMRGFNDGSVDNIYVDGLKS
MGDNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVALTTKKPLFAPYHQVQATMG
TQGQRGVGFDFSGPVDDDKRIAYRLTGLADASDTQFDHNKEERYAIAPAISVDFTEDTSL
TLQAYLQHDPNGGYHGGNPADGMLHKRNGLRLSDHFFEGEPSIDNYERTQQSFSYQFEHR
FNDVFTARQNFRYQDSDVSMDQVYSAGWADVDSNRLNRAYTGGDERLHSYIIDNMLQAEF
FTGAAKHTLLLGADYQRRKADVTWRYGTVDPLDAGNPQYGNGNLQVLGENRYQRRLQQTG
VYLQDLVELDQWRFSLGLRQDWVKVSEENRDSDSKVSDQRSRFTSRAGVLYLFENGIAPY
ISYSESFNPNTVSDQQGRPLAPTEGTQWEAGIKYQPPGSDNLFTASVFRIEQENLASKQP
DEDFYRPVGEVRSQGLELEAHVQLTDSLKLLGGYTFTDIEYSKSMPSLVSGDLDNKGNSP
TQAPKQMLSLWADYNFRQGALDGLRLGGGVRYVGYSWVDAENSMKVPSYTLFDASIGYDL
GKLGLTGVDVRLNANNLTNESYITSCASLNYCYMGEERNVSATVSYQF