Protein Info for PP_0157 in Pseudomonas putida KT2440

Annotation: transcriptional activator of gcdH, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00126: HTH_1" amino acids 10 to 66 (57 residues), 66 bits, see alignment E=2.3e-22 PF03466: LysR_substrate" amino acids 90 to 292 (203 residues), 122 bits, see alignment E=2.4e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0157)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RH3 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PP_0157 transcriptional activator of gcdH, LysR family (Pseudomonas putida KT2440)
MRRKIPSTAALICFEAAARNESFTKAAQELALTQGAVCRQIGGLEAFLNVELFRRSRRGV
RLTEAGLSYSRQVAAQLDAVERDTLSVMRQQGANVIELAVVPTFGTQWLLPRLKDFQQRH
PEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHQLMGENPVPVCSPALLNGQGML
EARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGPRYELFSMLAQAAMHDMGIALIP
PFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKVESASLRAFRDWLVSQAQAYINSSG
TNAAN