Protein Info for PP_0146 in Pseudomonas putida KT2440

Annotation: putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details PF03741: TerC" amino acids 23 to 213 (191 residues), 169.3 bits, see alignment E=3.8e-54

Best Hits

Swiss-Prot: 60% identical to Y056_HAEIN: UPF0053 protein HI_0056 (HI_0056) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0146)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RI3 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PP_0146 putative transport protein (Pseudomonas putida KT2440)
MPLPLEGKYMEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPRTRIFGL
ALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSSQEIYHGLEG
EDENVEEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIVVAVLVMML
CAGAISNFIDKHPSLKMLALSFLIVVGTVLIAEAFEVHVPKGYVYFAMAFSLAVEAINIR
MRTAMARKDGKDHEPVKLRKDIPGQ