Protein Info for PP_0143 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF19346: DUF5924" amino acids 1 to 257 (257 residues), 378.7 bits, see alignment E=1.3e-117 PF11141: DUF2914" amino acids 269 to 333 (65 residues), 84 bits, see alignment E=4.8e-28

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_0161)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RI6 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PP_0143 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MPQIPHIVQRIIELLKRYPGIIALGGFLSGIGSFILVDRQAGLASWVAVLMLVSWVWLML
ENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFITTTWNSGQLVFTGLLGAA
GLVSITDPLYYKWLAPRRWLFLALHTLTLFAALLTALPIILHLTTAQSFKLALIAAMALS
FPSLASSFPISNWRRAVALVLVTLSVGAGGWLLRSWVPPATLWMTEVAVSTEVMNRQPGD
SLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQKDGQEVDRIALDIHGGRKEGYRAW
THKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVVNDAPAGS