Protein Info for PP_0133 in Pseudomonas putida KT2440

Annotation: Alginate biosynthesis transcriptional regulatory protein AlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00072: Response_reg" amino acids 11 to 119 (109 residues), 104.1 bits, see alignment E=1.7e-33 PF00158: Sigma54_activat" amino acids 149 to 313 (165 residues), 215.9 bits, see alignment E=1e-67 PF14532: Sigma54_activ_2" amino acids 151 to 318 (168 residues), 55.3 bits, see alignment E=3.1e-18 PF07728: AAA_5" amino acids 170 to 290 (121 residues), 26.7 bits, see alignment E=1.7e-09 PF00004: AAA" amino acids 171 to 303 (133 residues), 22.9 bits, see alignment E=3.6e-08 PF02954: HTH_8" amino acids 407 to 446 (40 residues), 36.9 bits, see alignment 8.7e-13

Best Hits

Swiss-Prot: 100% identical to ALGB_PSEPK: Alginate biosynthesis transcriptional regulatory protein AlgB (algB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K11384, two-component system, NtrC family, response regulator AlgB (inferred from 100% identity to ppf:Pput_0150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RJ6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PP_0133 Alginate biosynthesis transcriptional regulatory protein AlgB (Pseudomonas putida KT2440)
MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAETLLQRQVFDLCFLDL
RLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAGAADYLVKPCSPDQLRLAT
AKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMMAVLETARQVAITDANILILGESGTG
KGELARAIHGWSKRARKACVTINCPSLNAELMESELFGHTRGAFTGASESTLGRVSQADG
GTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADVRILAATNLNLEEMVRESRF
REDLLYRLNVITLHLPPLRERSEDILILADRFLARFVKEYSRPARGFSDEARTALLNYRW
PGNIRELRNVVERASIICPQERVEISHLGMGEQPAGSAPRVGAALSLDELERAHIGAVLA
ASDTLDQAAKTLGIDASTLYRKRKQYNL