Protein Info for PP_0126 in Pseudomonas putida KT2440

Annotation: Cytochrome c4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00034: Cytochrom_C" amino acids 30 to 102 (73 residues), 33.4 bits, see alignment E=9.2e-12 amino acids 115 to 204 (90 residues), 41.2 bits, see alignment E=3.3e-14 PF13442: Cytochrome_CBB3" amino acids 36 to 99 (64 residues), 22.9 bits, see alignment E=8.6e-09

Best Hits

Swiss-Prot: 76% identical to CYC4_PSEAE: Cytochrome c4 (cc4) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0126)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RK3 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PP_0126 Cytochrome c4 (Pseudomonas putida KT2440)
MNKLVVSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNPDGNSLAPNFPKLAGQG
QRYLEKQLHDIKSGKRTVLEMTGMLAAFSDQDLADIAAYFSSQKGSVGAADPKLVERGRA
LFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQYVAKQLTDFREGNRTNDGDAM
TMRTIAGKLSNHDIEALASYIQGLH