Protein Info for PP_0118 in Pseudomonas putida KT2440

Annotation: zinc import ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 149 (129 residues), 96.6 bits, E=2.1e-31

Best Hits

Swiss-Prot: 100% identical to ZNUC_PSEPK: Zinc import ATP-binding protein ZnuC (znuC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to ppf:Pput_0135)

MetaCyc: 60% identical to Zn2+ ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.2.2.20

Sequence Analysis Tools

See Q88RL1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PP_0118 zinc import ATP-binding protein (Pseudomonas putida KT2440)
MSDALIRLDQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGKTTLVRAVLGLLKPHRG
KVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAALSALQEVGAEQVIDSPIQ
TISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTELYNLITRLRDRHGCGVLMVSH
DLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGKTAPSLAIYHHHHDHSHDLHG
SVVAPGTHVHGEHCKHG