Protein Info for PP_0103 in Pseudomonas putida KT2440

Annotation: cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details PF02790: COX2_TM" amino acids 23 to 104 (82 residues), 43.4 bits, see alignment E=6.5e-15 TIGR02866: cytochrome c oxidase, subunit II" amino acids 32 to 251 (220 residues), 188.2 bits, see alignment E=6.5e-60 PF00116: COX2" amino acids 121 to 240 (120 residues), 123.2 bits, see alignment E=1.1e-39 PF13442: Cytochrome_CBB3" amino acids 275 to 348 (74 residues), 43.7 bits, see alignment E=5.6e-15 PF00034: Cytochrom_C" amino acids 275 to 348 (74 residues), 30.7 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 99% identity to ppg:PputGB1_0117)

MetaCyc: 100% identical to cytochrome c oxidase subunit 2 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RM6 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PP_0103 cytochrome c oxidase subunit 2 (Pseudomonas putida KT2440)
MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHMTIFWICVIIGIVVFGA
MFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVVMAIPATKTLIDIYDASESDID
VQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDEHYLLEVDQPLVLPVGAKVRF
LVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRIEKPGIYRGQCTELCGKDHGFMPVVVE
VKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVERGDKVYHTTCVACHQAEGQGLPPM
FPALKGSKIATGPKEGHLSIVFHGKPGTAMAAFGKQLSEVDIAAVVTYERNAWGNNKGDM
VTPKDVLALKQAEAK