Protein Info for PP_0082 in Pseudomonas putida KT2440

Annotation: tryptophan synthase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00262: tryptophan synthase, alpha subunit
  • amino acids 8 to 257 (250 residues), 275.7 bits, E=1.2e-86
• PF00290: Trp_syntA
  • amino acids 8 to 263 (256 residues), 336.6 bits, E=1.1e-104
• PF00977: His_biosynth
  • amino acids 187 to 247 (61 residues), 26.8 bits, E=5.3e-10
• PF01884: PcrB
  • amino acids 187 to 240 (54 residues), 25.6 bits, E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to TRPA_PSEPK: Tryptophan synthase alpha chain (trpA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 100% identity to ppu:PP_0082)

MetaCyc: 41% identical to tryptophan synthase subunit alpha (Thermococcus kodakarensis)
Tryptophan synthase. [EC: 4.2.1.20]; Indole-3-glycerol-phosphate lyase. [EC: 4.2.1.20, 4.1.2.8]

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• DIBOA-glucoside biosynthesis (1/6 steps found)
• superpathway of benzoxazinoid glucosides biosynthesis (1/13 steps found)

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.1.2.8 or 4.2.1.20

Sequence Analysis Tools

See Q88RP7 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PP_0082 tryptophan synthase alpha chain (Pseudomonas putida KT2440)
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLVKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVTQAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVTDVLSLCSALAEGVRGARR