Protein Info for PP_0077 in Pseudomonas putida KT2440

Annotation: choline-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 TIGR03417: choline-sulfatase" amino acids 2 to 499 (498 residues), 888.6 bits, see alignment E=6.7e-272 PF00884: Sulfatase" amino acids 4 to 345 (342 residues), 166.3 bits, see alignment E=2e-52 PF01663: Phosphodiest" amino acids 7 to 291 (285 residues), 34.8 bits, see alignment E=2.9e-12 PF16347: SGSH_C" amino acids 295 to 432 (138 residues), 53 bits, see alignment E=9.1e-18 PF12411: Choline_sulf_C" amino acids 446 to 498 (53 residues), 90.1 bits, see alignment 1.2e-29

Best Hits

KEGG orthology group: K01133, choline-sulfatase [EC: 3.1.6.6] (inferred from 100% identity to ppu:PP_0077)

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.6

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RQ2 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PP_0077 choline-sulfatase (Pseudomonas putida KT2440)
MTRPNILFIMADQMAAPLLPIYGPSPIKMPHLGRLAEQAVVFDSAYCNSPLCAPSRFTLV
SGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHFCGPDQLHGYEERLTSDI
YPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLDFDEEVVFKARQYLYDHVREN
DGRPFCLTVSMTHPHDPYTIAKRYWDRYEGVDIPMPRAEFSQAELDPHSQRLLKVYDLWN
KPLPVDKVRDARRAYFGACSYIDDNIGQLLQTLEECNLADDTLIVFSGDHGDMLGERGLW
YKMHWFEMSARVPLLIHAPKRFAAGRVTASVSTCDLLPTLVELAGGAVDKDLQLDGRSLL
GHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGPYKFVYSEDDPCLLYDLSRDPHERENLTG
SPDHQVLLQAFVDEAQQRWDITSLRQQVLASQRRRRLVAEALAIGKLKSWDHQPLVDASQ
QYMRNHIDLDDLERKARYPQPAPLD