Protein Info for PP_0075 in Pseudomonas putida KT2440

Annotation: putative choline sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 40 to 67 (28 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 330 to 369 (40 residues), see Phobius details amino acids 385 to 416 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 22 to 391 (370 residues), 277.5 bits, see alignment E=2.4e-86 PF13466: STAS_2" amino acids 425 to 508 (84 residues), 40.3 bits, see alignment E=4.5e-14 PF01740: STAS" amino acids 433 to 510 (78 residues), 48.5 bits, see alignment E=9.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0075)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RQ4 at UniProt or InterPro

Protein Sequence (521 amino acids)

>PP_0075 putative choline sulfate transporter (Pseudomonas putida KT2440)
MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYITLVLLLTFLGGIFQLLLG
LLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMALPSQATALMTVQDLASHAGEV
DLPSLLLGLATVVIGAAFKLWRPRWPSLLISLILVSLLAWLLPGFFGHVPRVAAFTGQLP
PFSPLPLLDMELMLRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDPDQEIRAQGLSNI
AGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVALFAVTGAGLIAHLPIPAMAGS
ILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRIQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPIRFEE