Protein Info for PP_0070 in Pseudomonas putida KT2440

Annotation: Threonylcarbamoyl-AMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF01300: Sua5_yciO_yrdC" amino acids 14 to 185 (172 residues), 162.3 bits, see alignment E=4.3e-52

Best Hits

Swiss-Prot: 100% identical to TSAC_PSEPK: Threonylcarbamoyl-AMP synthase (tsaC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07566, putative translation factor (inferred from 99% identity to ppf:Pput_0086)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RQ9 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_0070 Threonylcarbamoyl-AMP synthase (Pseudomonas putida KT2440)
MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGLILIAD
NIRQFDFLFEDFPEDWIDRMSSTWPGPNTWLVPHQDLLPEWVTGQHDTVALRVSDHPVVR
ELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVLGGALGGRKNPSVIRDLATGE
VVRPG