Protein Info for PP_0061 in Pseudomonas putida KT2440

Annotation: glycine-tRNA ligase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 10 to 299 (290 residues), 540.6 bits, see alignment E=4.4e-167 PF02091: tRNA-synt_2e" amino acids 11 to 291 (281 residues), 504.2 bits, see alignment E=4.5e-156

Best Hits

Swiss-Prot: 100% identical to SYGA_PSEPK: Glycine--tRNA ligase alpha subunit (glyQ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 99% identity to ppw:PputW619_0080)

MetaCyc: 77% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RR8 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_0061 glycine-tRNA ligase alpha subunit (Pseudomonas putida KT2440)
MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAY
VQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVE
DNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYIQGVD
SVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEANRLIKLEL
PLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARARLGFPMAT
PELRDEVLAKLEAAQ