Protein Info for PP_0053 in Pseudomonas putida KT2440

Annotation: putative sulfide:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0053)

MetaCyc: 100% identical to sulfide:quinone oxidoreductase (Pseudomonas putida KT2440)
R17-RXN [EC: 1.8.5.4]

Predicted SEED Role

"FIG002984: FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

MetaCyc Pathways

sulfide oxidation I (to sulfur globules) (1/1 steps found)
sulfide oxidation III (to sulfite) (3/4 steps found)
superpathway of sulfide oxidation (Starkeya novella) (3/5 steps found)
superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (6/10 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (6/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RS6 at UniProt or InterPro

Protein Sequence (422 amino acids)

>PP_0053 putative sulfide:quinone oxidoreductase (Pseudomonas putida KT2440)
MPALLSPANTDHHKVVIVGAGAAGIATASSLISRDPSLDVALIDPAEVHYYQPGWTMVGA
GVFKAPSTARTMASTIPRGVRWVKARVKGFDPLAQLVILDDGRAISYEQLIVCPGLKLDW
AAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRALFSQPPMPIKCAGAPQKALYL
SCDHWLRHGHLGAVKASFYNAGAVLFGVADYVPALMKYIEKYAVDLNFSHRLVAVDGPGK
RATFLRTLPDGSSETRIEAFDMLHVVPPQVAPDFIRESPLADSSGWVDVDPHTLRHRKYT
NVHALGDVANTSNAKTAAAARKQAPVVANNVLVALGRLATLAQYDGYGSCPLTVERGKIV
LAEFTYGGKLAPSFPNWLLDGRKPTRLAWLLKAQALPPLYWQGMLKGREWLARPQLVAEG
GQ