Protein Info for PP_0035 in Pseudomonas putida KT2440

Annotation: putative bactoprenol-linked glycose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details PF04138: GtrA" amino acids 14 to 127 (114 residues), 71 bits, see alignment E=4.8e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppw:PputW619_0052)

Predicted SEED Role

"GtrA family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RU4 at UniProt or InterPro

Protein Sequence (139 amino acids)

>PP_0035 putative bactoprenol-linked glycose transferase (Pseudomonas putida KT2440)
MENQTPPLTTLLIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLASICGGMVGAIASFIGN
RALCFVADGSRKFQPVRFALVALTTNFGNGVGMWFLIKSNLSPLISQVVVTLSLTALGFI
AHRFWTFNHADITSLSRAP