Protein Info for PP_0024 in Pseudomonas putida KT2440

Annotation: putative membrane-associated metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 75 to 224 (150 residues), 169.8 bits, see alignment E=3.9e-54 PF00884: Sulfatase" amino acids 252 to 539 (288 residues), 226.9 bits, see alignment E=3.8e-71

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to ppg:PputGB1_0039)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RV5 at UniProt or InterPro

Protein Sequence (565 amino acids)

>PP_0024 putative membrane-associated metal-dependent hydrolase (Pseudomonas putida KT2440)
MTPSKSIVHTLLSKWIFAIRNARQKGISTNLLIGLVTFWLLLFANAELWNVLWKLVFKTD
EVNWQLAASLPVIVFAWVFTVLSLLSWGRLAKPILCLVLISASFASYFMNAYGIVIDYTM
FTNVVETDVAEATELLNWKLGLWVAMVGVLPVYLIARVPLRRKPWAKALVSRFIALSLAL
LTLSGIALSQYQSYASLLRNNREIRLILVPTNLFAAGHGYLKRQLASPKTLTAIGTDAVV
NRQGAARKPRLLVLAVGETARSANFSLNGYSRETNPELEKRNVISFTNVSSCGTATAVSL
PCMFLDVGKAQYKDGLAKSREGLLDVLQRAGISVMWTDNNSGCKGVCDRVPNHKAASHAD
SQLCTSEECKDGVLLTEMQDFIKRQEGDAVLVLHYKGSHGPAYYKRYPSQFKKFAPVCET
NELDKCKQEEVVNAYDNSILYTDYVTANLIDILAANTKFDTALMYVSDHGESLGEGGLYL
HGLPYAMAPDEQTKVPLVLWMSDSLAKSEKVNVGCLKAQTTSPLSHDNLFHTVLGMMNVQ
TSSYRSALDFTAPCKPFVGGSYSGL