Protein Info for PP_0011 in Pseudomonas putida KT2440

Annotation: DNA polymerase III subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF00712: DNA_pol3_beta" amino acids 1 to 119 (119 residues), 152 bits, see alignment E=1.2e-48 TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 367 (367 residues), 371.1 bits, see alignment E=2.9e-115 PF02767: DNA_pol3_beta_2" amino acids 130 to 244 (115 residues), 151.1 bits, see alignment E=2.4e-48 PF02768: DNA_pol3_beta_3" amino acids 247 to 366 (120 residues), 148.2 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 100% identical to DPO3B_PSEPU: Beta sliding clamp (dnaN) from Pseudomonas putida

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 100% identity to ppu:PP_0011)

MetaCyc: 56% identical to beta sliding clamp (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A120 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PP_0011 DNA polymerase III subunit beta (Pseudomonas putida KT2440)
MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE
EPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAGRSRFTLSTLPANDFPTVE
EGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSRNTLRAVSTDGHRLALC
SMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRATTGEFTFTSKLVDG
KFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSNEKYRGIRLQLAAGQLKIQANNPEQ
EEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALLQEAGNDDSSY
VVMPMRL