Protein Info for PP_0002 in Pseudomonas putida KT2440

Annotation: probable chromosome partition protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF13614: AAA_31" amino acids 3 to 178 (176 residues), 224.9 bits, see alignment E=2.5e-70 PF10609: ParA" amino acids 3 to 146 (144 residues), 36.4 bits, see alignment E=1.4e-12 PF09140: MipZ" amino acids 4 to 153 (150 residues), 40.8 bits, see alignment E=5.9e-14 PF06564: CBP_BcsQ" amino acids 5 to 246 (242 residues), 47.7 bits, see alignment E=5.2e-16 PF01656: CbiA" amino acids 6 to 228 (223 residues), 98.3 bits, see alignment E=1.2e-31 PF02374: ArsA_ATPase" amino acids 10 to 44 (35 residues), 25.7 bits, see alignment 2.3e-09

Best Hits

Swiss-Prot: 100% identical to YGIDB_PSEPU: Uncharacterized protein in gidB 3'region from Pseudomonas putida

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to ppf:Pput_5304)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A149 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PP_0002 probable chromosome partition protein (Pseudomonas putida KT2440)
MAKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSV
YDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRDNYD
YILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEG
LLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIRLAEAPSFGMPALAYDKQSRGAL
AYLALAGELVRRQRRPSRTAQTT