Protein Info for PP_0001 in Pseudomonas putida KT2440

Annotation: probable chromosome-partitioning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF02195: ParB_N" amino acids 26 to 127 (102 residues), 137.4 bits, see alignment E=2.7e-44 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 34 to 206 (173 residues), 206.3 bits, see alignment E=1.7e-65 PF17762: HTH_ParB" amino acids 130 to 228 (99 residues), 125.6 bits, see alignment E=1.2e-40 PF23552: ParB_C" amino acids 241 to 290 (50 residues), 89.2 bits, see alignment 1.4e-29

Best Hits

Swiss-Prot: 100% identical to PARB_PSEPK: Probable chromosome-partitioning protein ParB (parB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to ppu:PP_0001)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A151 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PP_0001 probable chromosome-partitioning protein (Pseudomonas putida KT2440)
MAVKKRGLGRGLDALLSGPSVSALEEQAVKIDQKELQHLPVELVQRGKYQPRRDMDPEAL
EELAHSIRNHGVMQPIVVRPIGDNRYEIIAGERRWRATQQAGLDTIPAMVREVPDEAAIA
MALIENIQREDLNPLEEAMALQRLQQEFELTQQQVADAVGKSRVTVANLLRLITLPDAIK
TMLAHGDLEMGHARALLGLDENRQEEGARHVVARGLTVRQTEALVRQWLSDKPDPVEPSK
PDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRYNSLDELQGVLAHIR