Protein Info for PFR28_05212 in Pseudomonas sp. RS175

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 923 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 172 to 189 (18 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 30 to 158 (129 residues), 58.4 bits, see alignment E=1.9e-19 PF07695: 7TMR-DISM_7TM" amino acids 171 to 373 (203 residues), 92.1 bits, see alignment E=1.2e-29 PF00512: HisKA" amino acids 397 to 462 (66 residues), 73.6 bits, see alignment 2.7e-24 PF02518: HATPase_c" amino acids 509 to 622 (114 residues), 54.1 bits, see alignment E=5.2e-18 PF00072: Response_reg" amino acids 642 to 758 (117 residues), 69.6 bits, see alignment E=6.2e-23 amino acids 792 to 906 (115 residues), 81.4 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a625)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (923 amino acids)

>PFR28_05212 Sensor histidine kinase RcsC (Pseudomonas sp. RS175)
MRWLRIAIGFTVTLLTLLCMLPAQAAPGSGWAVLLDEQGDLKLSDIRSARYTNQFSPIDL
DRLKAAEPGGALWLRFRLAPDKHEQILRIFAPDLSRLNLYVLDGDALIDQQIGGNAQPRT
EPSVPSSDVMLALPRSDKPLDVYLRLASRHELRPYITLQPAIMAAADQNQTLIYGLLFGC
IAMLILHNLTRYAYTRSRSCLWLAACEGLLMLSLVLLLNLAGGWLPDWPAVQTPGAYLAL
LLTAPCGLMFAYRFFAPLGPHPLNRLLLGDIVFIMLCCLLLLFVNTLPLNIMTYALVALA
GLSMLFVSAWHWQKGYRPARLFVAAMVVFNLGTLIILPALQGLTEVAPQGLIVTLLVFIC
ISGLLMSVALGERQRSINESRFSISRDLAASNAEINAKAEFLAKISHEIRTPMNGVLGMT
ELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILDISRLESGQIELDDVQFDLNALIEDC
LSIFRAKAEQQNVELISFIQPQVPRVISGDPTRLRQALLSLLENALKKTDEGEVLIVVAL
DERSKQPRLRIAVQDSGSPMDAEERDTLMHAELHSKNFLSATRLGGNLGLVIARQLIMLM
HGEFGIKSGNQGSTLWLTLPLDPDRLEHPTSDLDSPLQGARVLVVDDNETCRKVLVQQCS
AWGLNVSAVPSGKEALALLRTKAHLRDYFDVVLLDQNMPGMTGMQLAAKIKEDPSLNHDI
LLIMLTGISNAPSKIVARNSGVKRILAKPVAGYTLKTTLADELNQRNRGHAPSSPASAGP
TAPVKVPSDFRILVAEDNSISTKVIRGMLGKLNLQPDTASNGEEALKAMKEQRYDLVLMD
CEMPILDGFSATQQLRAWEMGNQRTRTPVVALTAHILAEHKERARQAGMDGHMAKPVELS
QLRELIEHWVAQREQQNRTAQTS