Protein Info for PFR28_05199 in Pseudomonas sp. RS175

Annotation: Precorrin-6A reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02571: CbiJ
  • amino acids 3 to 236 (234 residues), 204.9 bits, E=6.8e-65

Best Hits

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 86% identity to pba:PSEBR_a613)

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.54

Protein Sequence (242 amino acids)

>PFR28_05199 Precorrin-6A reductase (Pseudomonas sp. RS175)
MNRILLLGGVTEALAIARTLGPDHIYSLAGIGRVPTDLACQVRVGGYGGAQGLAQFIREH
HVDLLLDATHPYAARISHNAAQAARACGLPCWALRRPAWHPLAGDDWREVADWDALIQAL
QPFRRPLFTLGREPLQHLHEIPPEQFWTLRALDVYPGNERCEVIGARGPFNIDDERELFE
RRRIDVLISKNSGSTATEPKLEVARERGIPVLVLKRPPLPEVDREFGTLDELLAALSTSR
GS