Protein Info for PFR28_05158 in Pseudomonas sp. RS175

Annotation: Sulfoacetaldehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 4 to 164 (161 residues), 55.5 bits, E=1.1e-18
• PF00106: adh_short
  • amino acids 4 to 189 (186 residues), 163.7 bits, E=5.6e-52
• PF13561: adh_short_C2
  • amino acids 9 to 224 (216 residues), 117.5 bits, E=1.1e-37

Best Hits

Swiss-Prot: 59% identical to ISFD2_CHRSD: Sulfoacetaldehyde reductase 2 (isfD2) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a575)

MetaCyc: 60% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

• sulfoacetaldehyde degradation III (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Protein Sequence (254 amino acids)

>PFR28_05158 Sulfoacetaldehyde reductase (Pseudomonas sp. RS175)
MSNTLFITGATSGFGEACARRFAEAGWKLVLTGRREERLNALCAELSKQTEVHGLVLDVR
DRKAMEEAIANLPPSFATLRGLINNAGLALGVDPAPKCDLDDWDTMVDTNVKGLIYSTRL
LLPRLIAHGRGAGIINLGSIAGNYPYPGSHVYGASKAFVKQFSLNLRCDLQGTGVRVSNI
EPGLCESEFSLVRFGGDQERYNATYAGAEPIQPQDIAQTIFWVLNVPAHININSLELMPV
SQTWAGFAIERNKA