Protein Info for PFR28_05155 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details PF11862: DUF3382" amino acids 13 to 110 (98 residues), 74 bits, see alignment E=9.9e-25 PF02653: BPD_transp_2" amino acids 118 to 403 (286 residues), 165.7 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to pba:PSEBR_a572)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>PFR28_05155 hypothetical protein (Pseudomonas sp. RS175)
MSAANKPLDIKQSVIDAILAGLISLIVFGPIVGVVLDGYSFNLQPARVGWLVAVVMAGRF
ALSLFLQTPRGLKILQGFETTGSGVHVLPPDYKSRLRWIIPALIVIAIVFPFFANKYVLT
VVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWTVLPLAAI
AAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSFTGGPNGMPVPSPTFLGLE
FGRRAKEGGVPFHEFFGIDYNPNLKFLFIYIVLFITVLLVLYIKHRLTRMPVGRAWEALR
EDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNPSSFTFFESALILAIVV
LGGMGSTVGVVIAAFVLTVAPELLRSFSEYRVLLFGVLMVLMMIWRPRGLIRISRTGVTP
RKGVAP