Protein Info for PFR28_05154 in Pseudomonas sp. RS175

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 288 (280 residues), 165.7 bits, see alignment E=6e-53

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to pba:PSEBR_a571)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>PFR28_05154 High-affinity branched-chain amino acid transport system permease protein LivH (Pseudomonas sp. RS175)
MDGIFLQQLINGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLAAISLALLAY
FGIESFPLMILGTLVFTIVVTGVYGWVIERVAYKPLRNSTRLAPLISAIGISLILQNYAQ
ISQGARQQGVPTLLEGAMRVDIGTGFVQLTYTKIFILVAAFAGMALLTYIIKYTKLGRMC
RATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMNYGTFDFYAGFIIGIKAFT
AAVLGGIGSLPGAMLGGIILGISESLFSGLINSDYKDVFSFSLLVLILIFRPQGLLGRPL
VAKV