Protein Info for PFR28_05079 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 110 (17 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 204 to 220 (17 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 189 to 312 (124 residues), 58.4 bits, see alignment E=3.8e-20

Best Hits

KEGG orthology group: None (inferred from 54% identity to ppf:Pput_4808)

Predicted SEED Role

"lipopolysaccharide core biosynthesis protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>PFR28_05079 hypothetical protein (Pseudomonas sp. RS175)
MQATRWAQRWMAFGLFWFLLAIALAPSNKVYQQGLVIFVWLPAILFAWPARHRLAELWRA
QRVIYTALLALAVWSLITLCWADAPEPAREAKRLLYILVFLLSFAILADGQPERVIRIMQ
WGGVGLALTALMAIVHFYGVENNPWVARLEGLGELSHPILGGYVIGLAAIWLLHWVPRSI
GLQVVWAVALALLGVFVVMSQSRGAALALLLSVLAMPIYCRDQRSRVIAATALVLAMLTF
WLLEPLVLARGASYRPEIFMSSLHMIAEHPWGGLGLAADYRIPVGRISFDHAHNLFSHVA
IQLGLPGLALWCIAWFAVLREAWRARESLLGRGVLGMWIFSFLAMQFDAASLTGTPRAEW
FISWLPIGLAGVLTWARVKPGGCDKIPCSS