Protein Info for PFR28_04996 in Pseudomonas sp. RS175

Annotation: Poly(3-hydroxyalkanoate) polymerase subunit PhaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01839: poly(R)-hydroxyalkanoic acid synthase, class II
  • amino acids 1 to 559 (559 residues), 1039 bits, E=0
• PF07167: PhaC_N
  • amino acids 75 to 243 (169 residues), 216.6 bits, E=2e-68
• PF00561: Abhydrolase_1
  • amino acids 239 to 486 (248 residues), 97.4 bits, E=1.1e-31

Best Hits

Swiss-Prot: 83% identical to PHAC1_PSEOL: Poly(3-hydroxyalkanoate) polymerase 1 (phaC1) from Pseudomonas oleovorans

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 95% identity to pba:PSEBR_a410)

MetaCyc: 82% identical to poly[R)-3-hydroxydecanoate polymerase (Pseudomonas putida GPo1)
RXN-11796 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

• polyhydroxybutanoate biosynthesis (2/3 steps found)
• polyhydroxydecanoate biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Protein Sequence (559 amino acids)

>PFR28_04996 Poly(3-hydroxyalkanoate) polymerase subunit PhaC (Pseudomonas sp. RS175)
MSNKNNDDLKNQASENTLGLNPVVGLRRKDLLASARMVLTQTLKQPLHSARHVAHFGAEL
KKVLFGQSELQPSSDDRRFTDPAWSQNPLYKRYLQTYLAWRKELHAWIDDSNLPPQDISR
GHFVINLMTEAMAPTNTAANPAAVKRFFETGGKSLLDGLSHLAKDLVHNGGMPSQVDMGA
FEVGKSLGVTEGAVVFRNDVLELIQYRPITEQVHERPLLVVPPQINKFYVFDLSPDKSLA
RFCLRSNVQTFIVSWRNPTKEQREWGLSTYIEALKEAVDVVTAITGSKDVNMLGACSGGI
TCTALLGHYAALGEKKVNALTLLVSVLDTTLDTDVALFVDEQTLETAKRHSYQAGVLEGR
DMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNNDTTRLPAAFHGDLIEMFKTNP
LTRPNALEVCGTPIDLKQVTSDIFALAGTNDHITPWKSCYKSAQLFGGKVDFVLSSSGHI
QSILNPPGNPKSRYMTSEDMPAKAEDWQENSTKHTDSWWLHWQAWQAERSGKLKKAPSVL
GNKTYPAGEAAPGTYVHER