Protein Info for PFR28_04936 in Pseudomonas sp. RS175

Annotation: Carboxy-terminal processing protease CtpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 62 to 383 (322 residues), 353.8 bits, see alignment E=4.4e-110 PF00595: PDZ" amino acids 107 to 175 (69 residues), 42.2 bits, see alignment E=1.7e-14 PF13180: PDZ_2" amino acids 108 to 179 (72 residues), 45.5 bits, see alignment E=1.5e-15 PF17820: PDZ_6" amino acids 123 to 177 (55 residues), 50.6 bits, see alignment 2.7e-17 PF03572: Peptidase_S41" amino acids 206 to 371 (166 residues), 197.2 bits, see alignment E=2.9e-62

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 98% identity to pba:PSEBR_a349)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>PFR28_04936 Carboxy-terminal processing protease CtpB (Pseudomonas sp. RS175)
MLHLSRLTSLALTIALVIGAPLAFAAEPAPSSTAATAATTKAPLPLDELRTFAEVMDRIK
AAYVEPVDDKMLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGSEDGF
IKVVSPIDDTPASKAGIQAGDFIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGG
TPFDVTLTRAVIQVKSVKSQLLESGYGYIRITQFQVKTGEEVAKALAKLRKDNGKKLNGM
VLDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGNDLSEAVPLVVLIN
GGSASASEIVAGALQDQKRGVVMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSI
QAQGIVPDIEVRKAKITSEQDSEYFKEADLQGHLGNGNGGADKPTGSGAKAKPMPQDDDY
QLAQALSLLKGLNITSGR