Protein Info for PFR28_04915 in Pseudomonas sp. RS175

Annotation: Octopine permease ATP-binding protein P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 23 to 182 (160 residues), 123 bits, E=1.5e-39
• PF13304: AAA_21
  • amino acids 111 to 212 (102 residues), 29.8 bits, E=6.1e-11

Best Hits

Swiss-Prot: 68% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a330)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Protein Sequence (257 amino acids)

>PFR28_04915 Octopine permease ATP-binding protein P (Pseudomonas sp. RS175)
MAQATPALEIRNLHKRYGQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPN
QGQILVAGEELKLKAAKNGELVAADGRQINRMRSEIGFVFQNFNLWPHMSVLDNIIEAPR
RVLGQSKAEAIEVAEALLAKVGIADKRHAYPAELSGGQQQRAAIARTLAMQPKVILFDEP
TSALDPEMVQEVLSVIRALAEEGRTMLLVTHEMGFARQVSSEVVFLHQGLVEEQGSPQQV
FENPLSARCKQFMSSNR