Protein Info for PFR28_04887 in Pseudomonas sp. RS175

Annotation: '3'(2'),5'-bisphosphate nucleotidase CysQ' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00459: Inositol_P
  • amino acids 8 to 254 (247 residues), 182.7 bits, E=5.2e-58
• TIGR01331: 3'(2'),5'-bisphosphate nucleotidase
  • amino acids 9 to 258 (250 residues), 284.8 bits, E=3.3e-89

Best Hits

Swiss-Prot: 52% identical to CYSQ_SHIFL: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Shigella flexneri

KEGG orthology group: K03677, CysQ protein (inferred from 91% identity to pba:PSEBR_a300)

MetaCyc: 51% identical to 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli K-12 substr. MG1655)
3'(2'),5'-bisphosphate nucleotidase. [EC: 3.1.3.7]

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Protein Sequence (275 amino acids)

>PFR28_04887 '3'(2'),5'-bisphosphate nucleotidase CysQ' transl_table=11 (Pseudomonas sp. RS175)
MNYPHPLMAPVIELALKAGEAILPFWRANVQVDRKADESPVTAADMAAHDVIVAGLTALA
PQIPILSEEDADIAQDLRAGWQRWWLVDPLDGTKEFISGSEEFTVNIALIEQGQVVFGVV
SMPTSGRFYVGGAGLGAWRGDKGGEPSPIEVRHALVPGETFTVVASRRHTSPEQERLLDG
LSQSLGELQLTSIGSSLKFCLVAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDLSG
EVFCYPPRESLLNASFLALPAKAAWRGKLLELARS