Protein Info for PFR28_04825 in Pseudomonas sp. RS175

Annotation: Mercuric resistance operon regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR02047: Cd(II)/Pb(II)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 200.8 bits, see alignment E=3.4e-64 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 77.1 bits, see alignment E=1.4e-25 PF00376: MerR" amino acids 2 to 39 (38 residues), 62.4 bits, see alignment E=4.1e-21 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 68.2 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 39% identical to ZNTR_ECOLI: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a241)

Predicted SEED Role

"Cd(II)/Pb(II)-responsive transcriptional regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>PFR28_04825 Mercuric resistance operon regulatory protein (Pseudomonas sp. RS175)
MKIGELAKMTDCQVETIRYYEREGLLPEPARSDGNYRVYTQAHAERLTFIRNCRTLDMTL
EEIRSLLALRDSPQDQCESVNALIDEHILHVRARIDGLLALQAQLIDLRHRCGEGPDPDQ
CGILQRLEVSGAVAPEVEHSHVGRSHGH