Protein Info for PFR28_04812 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 46 (17 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details PF01957: NfeD" amino acids 87 to 169 (83 residues), 43.4 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 73% identity to pba:PSEBR_a230)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>PFR28_04812 hypothetical protein (Pseudomonas sp. RS175)
MNIRGLTVALLLTLGGPALASEGFTLAAADTLGFWLIALGVGLLIAEAALPNYGVAGLGG
IILCVVGAIILTDTHVPAPLMIGLGLASGLLLVALLIRALKTRPRRAVSGDAALLGSVTT
ITGLQAGNPHHGWVWLEGERWQVACATPMRAGQAVRVTARKGLLLEVAPADSQGA